PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g067250.1
Common NameMTR_4g067250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 581aa    MW: 65608.2 Da    PI: 5.4816
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g067250.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.74.6e-07437480146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r +W++++ e++++a k++G + ++ I + +   +t+ q+k+++ +
  Medtr4g067250.1 437 RVKWSKQDTEKFYEALKEFGLD-FTMIQQIFA-SKTRRQIKLKFKN 480
                      789*****************99.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159638.5E-25430509No hitNo description
Gene3DG3DSA:1.10.10.604.6E-4433480IPR009057Homeodomain-like
SMARTSM007174.6E-6436484IPR001005SANT/Myb domain
CDDcd001673.67E-6439480No hitNo description
SuperFamilySSF466893.44E-8439484IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MYYSLPIVGG IILMIYSHIC WYQYYKNNNS TDPASSLLNF EAEPEIEIAD LKPQLSGGFA  60
VQSLKTHQKK RPTCLMDLFD DILLEVPPAP ARPSAKFAPK VKSKQSLRKE ISASEHATSS  120
VDGKNMHVAS TPTVTKSIRD TNLDNDGAES ELNKVPSPST AFLDSNKSLQ VNNSLQDSLN  180
VGFKSSSGDN STAISENNIH SIFTSGKVQE DANERKQSLR KRKRSYVAGV EDDRDKSSRQ  240
LRKQVACEHV KNSNSLIEDD DELDPPYICN NIDQIEENDD EDEVDNSSKK KRALTNSKKK  300
YMSKNGKAYK KSKKENGDSE KTTKEPPKKF SRSSRRRKRQ VDQALLDDYE LGSRSISLRD  360
ILAISDDKER QEKKEAKSST NQSGGDFFHD AGANNEEETF SSDDDGLRDQ EDDQASKKFA  420
STVPLYNSHS FRDKSPRVKW SKQDTEKFYE ALKEFGLDFT MIQQIFASKT RRQIKLKFKN  480
EDQHHPLRIT DAINSHSSDH HIFKSVIAKL PQISTTNANQ EATEDTTEDM SPGINEQVAT  540
TEQDSADVKD QEDPMAYQSP EQFDDSDDDL WKWSQYQSVI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456296.10.0hypothetical protein MTR_4g067250
TrEMBLA0A072UKV60.0A0A072UKV6_MEDTR; Uncharacterized protein
STRINGGLYMA01G43821.15e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-26MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]